.
The Open Protein Structure Annotation Network
PDB Keyword
.

1squ

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein CheX from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 1squ Target Id APC4842
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4626,AAD36685, 2336 Molecular Weight 16448.20 Da.
    Residues 155 Isoelectric Point 5.47
    Sequence mdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliysfssetalkvv sammggmeynqldelalsaigelgnmtagklamklehlgkhvditpptvvsgrdlkiksfgvilklpis vfseedfdlhlsvksgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.32
    Matthews' coefficent 2.40 Rfactor 0.239
    Waters 5 Solvent Content 48.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1squ
    1. Structure and function of an unusual family of protein phosphatases: the bacterial chemotaxis proteins CheC and CheX
    SY Park, X Chao, G Gonzalez-Bonet, BD Beel - Molecular cell, 2004 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch