.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sr8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.9A crystal structure of cobalamin biosynthesis protein (cbiD) from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1sr8 Target Id APC5044
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4654,NP_069557, 2234 Molecular Weight 33161.38 Da.
    Residues 298 Isoelectric Point 8.32
    Sequence mlidpielyrypekwikdrdaekkvrsglyiltedgylrrgittgttasaaavaaiaslkekvekvkvs tpagvdveveveaekgfarvrkfsgdhefdvtngiifeaevcetsgiffgrgvgvkagekavsrsaklq ilenfikasrefnfsggvrisvpdgeevakktgnekvgikggisilgttgfvepwckklvetklkiamq yhriaittgrkawlyarkkfpeyqpfvfgvhidealkhpgekiivgfpgllkiwagsrdrieerareeg vrvvvieddmdswvwdvqgtdh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.258
    Matthews' coefficent 2.61 Rfactor 0.209
    Waters 135 Solvent Content 52.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sr8
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Fine-tuning our knowledge of the anaerobic route to cobalamin (vitamin B12)
    CA Roessner, AI Scott - Journal of bacteriology, 2006 - Am Soc Microbiol
     
    3. SPA: Short peptide analyzer of intrinsic disorder status of short peptides
    B Xue, WL Hsu, JH Lee, H Lu, AK Dunker - Genes to , 2010 - Wiley Online Library
     
    4. Cloning, purification and preliminary crystallographic analysis of cobalamin methyltransferases from Rhodobacter capsulatus
    A Seyedarabi, T Hutchison, TT To, E Deery - Section F: Structural , 2010 - scripts.iucr.org
     
    5. The anaerobic biosynthesis of vitamin B12
    JM Simon, JW Martin - Biochemical Society Transactions, 2012 - test.biochemsoctrans.org
     
    6. The anaerobic biosynthesis of vitamin B12
    SJ Moore, MJ Warren - Biochemical Society Transactions, 2012 - test.biochemsoctrans.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch