.
The Open Protein Structure Annotation Network
PDB Keyword
.

1su1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical characterization of Yfce, a phosphoesterase from E. coli. To be Published
    Site MCSG
    PDB Id 1su1 Target Id APC50002
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS5547,P76495, 562 Molecular Weight 20121.03 Da.
    Residues 184 Isoelectric Point 5.63
    Sequence mmklmfasdihgslpatervlelfaqsgaqwlvilgdvlnhgprnalpegyapakvaerlnevahkvia vrgncdsevdqmllhfpitapwqqvllekqrlflthghlfgpenlpalnqndvlvyghthlpvaeqrge ifhfnpgsvsipkggnpasygmldndvlsvialndqsiiaqvainp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.252
    Matthews' coefficent 2.76 Rfactor 0.213
    Waters 362 Solvent Content 55.39

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 1su1
    1. Prediction of transition metal_binding sites from apo protein structures
    M Babor, S Gerzon, B Raveh - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Structural and biochemical characterization of a novel Mn2+_dependent phosphodiesterase encoded by the yfcE gene
    DJ Miller, L Shuvalova, E Evdokimova - Protein , 2007 - Wiley Online Library
     
    3. Mutations in MMP9 and MMP13 Determine the Mode of Inheritance and the Clinical Spectrum of Metaphyseal Anadysplasia
    E Lausch, R Keppler, K Hilbert, V Cormier-Daire - The American Journal of , 2009 - Elsevier
     
    4. An Fe2+-Dependent Cyclic Phosphodiesterase Catalyzes the Hydrolysis of 7, 8-Dihydro-d-neopterin 2_, 3_-Cyclic Phosphate in Methanopterin Biosynthesis
    Z Mashhadi, H Xu, RH White - Biochemistry, 2009 - ACS Publications
     
    5. Identification and Characterization of the Enzymes Involved in Biosynthesis of FAD and Tetrahydromethanopterin in Methanocaldococcus jannaschii
    Z Mashhadi - 2010 - scholar.lib.vt.edu
     
    6. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch