.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t06

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.9A crystal structure of a hypothetical protein from Bacillus cereus ATCC 14579. To be Published
    Site MCSG
    PDB Id 1t06 Target Id APC24929
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5314,AAP10205, 226900 Molecular Weight 26474.90 Da.
    Residues 235 Isoelectric Point 6.14
    Sequence mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatgnydamyfag iiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasgdelkmsagwscycwllgn rkdnafseskisdmlemvkdtihhspertksamnnflntvaisyvplhekaveiakevgivevkrdnkk ssllnasesiqkeldrgrlgfkrkyvrc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 2.35 Rfactor 0.196
    Waters 405 Solvent Content 44.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t06
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. De novo design of a single-chain diphenylporphyrin metalloprotein
    GM Bender, A Lehmann, H Zou, H Cheng - Journal of the , 2007 - ACS Publications
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Identification of DNA-binding proteins using structural, electrostatic and evolutionary features
    G Nimrod, A Szilgyi, C Leslie, N Ben-Tal - Journal of molecular biology, 2009 - Elsevier
     
    5. Structural insight into repair of alkylated DNA by a new superfamily of DNA glycosylases comprising HEAT-like repeats
    B Dalhus, IH Helle, PH Backe, I Alseth - Nucleic acids , 2007 - Oxford Univ Press
     
    6. A new protein architecture for processing alkylation damaged DNA: the crystal structure of DNA glycosylase AlkD
    EH Rubinson, AH Metz, J O'Quin - Journal of molecular , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch