.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t0b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Analysis of chemical interactions in ThuA-like protein from Bacillus Stearothermophilus. To be Published
    Site MCSG
    PDB Id 1t0b Target Id APC35865
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5520,RBSTP2543, 1422 Molecular Weight 28722.33 Da.
    Residues 252 Isoelectric Point 5.47
    Sequence snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevldrcd vlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwreadekerlwvvap ghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsgctftrgkgkifyfrpghetypt yhhpdvlkvianavrwaapvnrgeivfgnvkplepikakqggvtq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.70 Rfree 0.17536
    Matthews' coefficent 2.50 Rfactor 0.14467
    Waters 1624 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 1t0b
    1. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    2. Novel hexamerization motif is discovered in a conserved cytoplasmic protein from Salmonella typhimurium
    T Petrova, ME Cuff, R Wu, Y Kim, D Holzle - Journal of structural and , 2007 - Springer
     
    3. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch