.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t0t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of APC35880 protein from Bacillus Stearothermophilus. To be Published
    Site MCSG
    PDB Id 1t0t Target Id APC35880
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5523,RBSTP1918, 1422 Molecular Weight 28785.19 Da.
    Residues 248 Isoelectric Point 5.06
    Sequence mseaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavytivgqkad ilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedpyqipevrrrlypilpkt nyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqiitgsvglddfewgvtlfsddal qfkklvyemrfdevsarfgefgsffvgtrlpmenvssffhv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.75 Rfree 0.194
    Matthews' coefficent 2.70 Rfactor 0.156
    Waters 1325 Solvent Content 53.70

    Ligand Information
    Ligands P33 (3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL) x 5
    Metals MG (MAGNESIUM) x 5

    Jmol

     
    Google Scholar output for 1t0t
    1. DyP-type peroxidases comprise a novel heme peroxidase family
    Y Sugano - Cellular and molecular life sciences, 2009 - Springer
     
    2. Crystal structures of two novel dye_decolorizing peroxidases reveal a __barrel fold with a conserved heme_binding motif
    C Zubieta, S Krishna, M Kapoor - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Identification and structural characterization of heme binding in a novel dye_decolorizing peroxidase, TyrA
    C Zubieta, R Joseph, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Crystal structure of chlorite dismutase, a detoxifying enzyme producing molecular oxygen
    DC de Geus, EAJ Thomassen, PL Hagedoorn - Journal of molecular , 2009 - Elsevier
     
    5. Haloferax volcanii PitA: an example of functional interaction between the Pfam chlorite dismutase and antibiotic biosynthesis monooxygenase families?
    E Bab-Dinitz, H Shmuely, J Maupin-Furlow - , 2006 - Oxford Univ Press
     
    6. Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase
    BR Goblirsch, BR Streit, JL DuBois - Journal of Biological , 2010 - Springer
     
    7. Structural and functional characterisation of the chlorite dismutase from the nitrite-oxidizing bacterium
    J Kostan, B Sjoblom, F Maixner, G Mlynek - Journal of structural , 2010 - Elsevier
     
    8. Unexpected Diversity of Chlorite Dismutases: a Catalytically Efficient Dimeric Enzyme from Nitrobacter winogradskyi
    G Mlynek, B Sjblom, J Kostan, S Freder - Journal of , 2011 - Am Soc Microbiol
     
    9. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    10. Crystallization and preliminary X-ray diffraction of chlorite dismutase from Dechloromonas aromatica RCB
    BR Goblirsch, BR Streit, JL DuBois - Section F: Structural , 2009 - scripts.iucr.org
     
    11. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    12. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    13. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch