.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1t33 Target Id APC24365
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5294,NP_459797, 99287 Molecular Weight 25093.37 Da.
    Residues 224 Isoelectric Point 5.70
    Sequence mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwiadf lgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlskfisreqlsptsayqlvhe qvidplhthltrlvaaytgcdandtrmilhthallgevlafrlgketillrtgwpqfdeekaeliyqtv tchidlilhgltqrsld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.253
    Matthews' coefficent 3.66 Rfactor 0.205
    Waters 194 Solvent Content 64.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t33
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    3. Evolutionary trace annotation of protein function in the structural proteome
    S Erdin, RM Ward, E Venner, O Lichtarge - Journal of molecular biology, 2010 - Elsevier
     
    4. Crystal Structure of Bacillus cereus HlyIIR, a Transcriptional Regulator of the Gene for Pore-forming Toxin Hemolysin II
    OV Kovalevskiy, AA Lebedev, AK Surin - Journal of molecular , 2007 - Elsevier
     
    5. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    6. Crystal structure of a putative HTH_type transcriptional regulator yxaF from Bacillus subtilis
    J Seetharaman, D Kumaran - Proteins: Structure, , 2006 - Wiley Online Library
     
    7. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    8. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    9. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch