.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t57

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Protein MTH1675 from Methanobacterium thermoautotrophicum. To be Published
    Site MCSG
    PDB Id 1t57 Target Id APC049
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS4428,O27711, 145262 Molecular Weight 20070.90 Da.
    Residues 186 Isoelectric Point 4.90
    Sequence mekkicyfeepgkentervlelvgeradqlgirnfvvasvsgetalrlsemvegnivsvthhagfrekg qleledeardallergvnvyagshalsgvgrgisnrfggvtpveimaetlrmvsqgfkvcveiaimaad aglipvdeeviaiggtawgadtalvltpahmnsvfdlriheviamprp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.318
    Matthews' coefficent 2.60 Rfactor 0.252
    Waters 126 Solvent Content 53.00

    Ligand Information
    Ligands FMN (FLAVIN) x 3
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1t57
    1. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Flavogenomicsa genomic and structural view of flavin_dependent proteins
    P Macheroux, B Kappes, SE Ealick - FEBS Journal, 2011 - Wiley Online Library
     
    3. Functional site prediction selects correct protein models
    V Chelliah, WR Taylor - BMC bioinformatics, 2008 - biomedcentral.com
     
    4. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    5. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch