.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t5b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.4 A crystal structure of a protein from Salmonella typhimurium similar to E. coli acyl carrier protein phosphodiesterase. To be Published
    Site MCSG
    PDB Id 1t5b Target Id APC24466
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5298,NP_460601, 99287 Molecular Weight 21626.63 Da.
    Residues 201 Isoelectric Point 5.20
    Sequence mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamrpgdapltpr qqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfrytekgpeglvtgkravvl ssrggihkdtptdliapylkvflgfigitdvnfvfaegiaygpevaakaqadakaaidsvvaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.223
    Matthews' coefficent 2.42 Rfactor 0.196
    Waters 392 Solvent Content 47.30

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1t5b
    1. Crystal structure of an aerobic FMN-dependent azoreductase (AzoA) from Enterococcus faecalis
    ZJ Liu, H Chen, N Shaw, SL Hopper, L Chen - Archives of biochemistry , 2007 - Elsevier
     
    2. Molecular Cloning, Characterisation and Ligand-bound Structure of an Azoreductase from Pseudomonas aeruginosa
    CJ Wang, C Hagemeier, N Rahman, E Lowe - Journal of molecular , 2007 - Elsevier
     
    3. Functional role of Trp-105 of Enterococcus faecalis azoreductase (AzoA) as resolved by structural and mutational analysis
    H Chen, H Xu, O Kweon, S Chen - Microbiology, 2008 - Soc General Microbiol
     
    4. A novel mechanism for azoreduction
    A Ryan, N Laurieri, I Westwood, CJ Wang - Journal of molecular , 2010 - Elsevier
     
    5. Role of tyrosine 131 in the active site of paAzoR1, an azoreductase with specificity for the inflammatory bowel disease prodrug balsalazide
    CJ Wang, N Laurieri, A Abuhammad - Section F: Structural , 2009 - scripts.iucr.org
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch