.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1t6a Target Id APC35969
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5530,RBSTP2229, 1422 Molecular Weight 13810.18 Da.
    Residues 125 Isoelectric Point 7.96
    Sequence mntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylqgdgrlykgma isvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrtmvfgsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.22462
    Matthews' coefficent 4.10 Rfactor 0.19429
    Waters 100 Solvent Content 69.70

    Ligand Information
    Ligands NO3 (NITRATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1t6a
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structure of LP2179, the first representative of Pfam family PF08866, suggests a new fold with a role in amino-acid metabolism
    C Bakolitsa, A Kumar, D Carlton, MD Miller - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch