.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t8h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 A CRYSTAL STRUCTURE OF AN UNCHARACTERIZED B. STEAROTHERMOPHILUS PROTEIN. To be Published
    Site MCSG
    PDB Id 1t8h Target Id APC35791
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5510,RBSTP0554, 1422 Molecular Weight 30114.48 Da.
    Residues 277 Isoelectric Point 5.90
    Sequence snampdifqqeargwlrcgappfagavaglttkhggeskgpfaslnmglhvgddrtdvvnnrrrlaewl afplerwvcceqvhgadiqkvtksdrgngaqdfatavpgvdglytdeagvllalcfadcvpiyfvapsa glvglahagwrgtaggiaghmvwlwqtrehiapsdiyvaigpaigpccytvddrvvdslrptlppespl pwretspgqyaldlkeanrlqllaagvpnshiyvserctsceealffshrrdrgttgrmlafigrreewt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21
    Matthews' coefficent 2.30 Rfactor 0.18
    Waters 250 Solvent Content 46.00

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1t8h
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     
    4. Crystal structure of hypothetical protein YfiH from Shigella flexneri at 2 resolution
    Y Kim, N Maltseva, I Dementieva - Proteins: Structure, , 2006 - Wiley Online Library
     
    5. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch