.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tlj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein SSO0622 from Sulfolobus solfataricus. To be Published
    Site MCSG
    PDB Id 1tlj Target Id APC3600
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS4592,Q9UX16, 2287 Molecular Weight 24113.73 Da.
    Residues 209 Isoelectric Point 9.37
    Sequence mlvweelrekalnkiyhdkeigyldpdilgfllafyrnrndvytqsscsgritivdaempwdrknstii fknhlriteqdledvlsknqvrrlwlivqgpiihiyaknietgwdilkiareagfkhsgilatnqkgvl velrtgirmvhllresntervdkdkiktlvnvcnevlargkqkmnllkdllssssnnsmelgknsklktpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.2716
    Matthews' coefficent 2.80 Rfactor 0.2232
    Waters 247 Solvent Content 0.56

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1tlj
    1. The RAGNYA fold: a novel fold with multiple topological variants found in functionally diverse nucleic acid, nucleotide and peptide-binding proteins
    S Balaji, L Aravind - Nucleic acids research, 2007 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch