.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tt4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of NP459575, a predicted glutathione synthase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1tt4 Target Id APC22989
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5248,NP_459575, 99287 Molecular Weight 41594.95 Da.
    Residues 372 Isoelectric Point 5.47
    Sequence malndfhvsepytlgielemqvinppgydlsqdsstlidavkpqltageikhditesmlematgvcrdi dqaaaqlsamqhvilqaasehhlgicgggthpfqkwqrqevcdneryqrtlenfgyliqqatvfgqhvh vgcangddaiyllhglshfvphfialsaaspymqgadtrfacarlnifsafpdngpmpwvsnwqefagl frrlsyttmidsikdlhwdirpspafgtvevrvmdtpltldhainmagliqatahwllterpfkpqeqd yllykfnrfqacryglegvltdaytgdrrrladdtlrlldnvtpsarklgadsaidalrlqvkkggnea qymrefiadggsliglvqkhceiwagq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.25768
    Matthews' coefficent 3.20 Rfactor 0.20884
    Waters 39 Solvent Content 61.50

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1tt4
    1. Efficient protein tertiary structure retrievals and classifications using content based comparison algorithms
    PH Chi - 2007 - mospace.umsystem.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch