.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tua

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a hypothetical protein APE0754 from Aeropyrum pernix. To be Published
    Site MCSG
    PDB Id 1tua Target Id APC5052
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS4662,NP_147468, 272557 Molecular Weight 21662.27 Da.
    Residues 190 Isoelectric Point 9.09
    Sequence mkpriyvkvkperlgavigprgevkaeimrrtgtvitvdtensmvivepeaegippvnlmkaaevvkai slgfppekafrlleedqilvvvdlkqvvgdsqnhlkrikgriigeggrarrtieemtdtyinvgeyeva iigdyeramaakqaiemlaegrmhstvyrhlerimreikrrerlkmwareel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.229
    Matthews' coefficent 2.41 Rfactor 0.208
    Waters 164 Solvent Content 47.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tua
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Protein structure database search and evolutionary classification
    JM Yang, CH Tung - Nucleic acids research, 2006 - Oxford Univ Press
     
    3. Crystal structure of Dim2p: A preribosomal RNA processing factor, from Pyrococcus horikoshii OT3 at 2.30
    MZ Jia, J Ohtsuka, WC Lee, K Nagata - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library
     
    5. Crystallization and preliminary X-ray analysis of PH1566, a putative ribosomal RNA-processing factor from the hyperthermophilic archaeon Pyrococcus horikoshii OT3
    MZ Jia, J Ohtsuka, WC Lee, K Nagata - Section F: Structural , 2005 - scripts.iucr.org
     
    6. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch