.
The Open Protein Structure Annotation Network
PDB Keyword
.

1twu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.0 A crystal structure of a hypothetical protein yycE from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1twu Target Id APC1848
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4570,P37479, 1423 Molecular Weight 15586.78 Da.
    Residues 139 Isoelectric Point 5.47
    Sequence mgkrfssfqaaqiriarptgqldeiirfyeeglclkrigefsqhngydgvmfglphadyhleftqyegg stapvphpdsllvfyvpnavelaaitsklkhmgyqevesenpywsnggvtiedpdgwrivfmnskgisgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.233
    Matthews' coefficent 3.21 Rfactor 0.207
    Waters 79 Solvent Content 60.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1twu
    1. Structure_based function inference using protein family_specific fingerprints
    D Bandyopadhyay, J Huan, J Liu, J Prins - Protein , 2006 - Wiley Online Library
     
    2. Identification of family-specific residue packing motifs and their use for structure-based protein function prediction: II. Case studies and applications
    D Bandyopadhyay, J Huan, J Prins, J Snoeyink - Journal of computer- , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch