.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tz0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein APC24875 from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1tz0 Target Id APC24875
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5308,AAP09917, 226900 Molecular Weight 12776.90 Da.
    Residues 111 Isoelectric Point 6.09
    Sequence mgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirweseeawknw etseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.26073
    Matthews' coefficent 3.10 Rfactor 0.20398
    Waters 417 Solvent Content 60.00

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1tz0
    1. Haloferax volcanii PitA: an example of functional interaction between the Pfam chlorite dismutase and antibiotic biosynthesis monooxygenase families?
    E Bab-Dinitz, H Shmuely, J Maupin-Furlow - , 2006 - Oxford Univ Press
     
    2. A novel chimera: The truncated hemoglobin-antibiotic monooxygenase from Streptomyces avermitilis
    A Bonamore, A Attili, F Arenghi, B Catacchio - Gene, 2007 - Elsevier
     
    3. Solubilization and characterization of the anthrax toxin pore in detergent micelles
    G Vernier, J Wang, LD Jennings, J Sun - Protein , 2009 - Wiley Online Library
     
    4. The crystal structure of Rv0793, a hypothetical monooxygenase from M._ tuberculosis
    MJ Lemieux, C Ference, MM Cherney, M Wang - Journal of structural and , 2005 - Springer
     
    5. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    6. TA Binkowski, A Joachimiak - BMC structural biology, 2008 - BioMed Central Ltd
    30
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch