.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of hypothetical protein PA4716 from Pseudomonas aeruginosa. TO BE PUBLISHED
    Site MCSG
    PDB Id 1u0k Target Id APC5053
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4663,AAG08102, 208964 Molecular Weight 30848.98 Da.
    Residues 284 Isoelectric Point 5.18
    Sequence msrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafrariftleee lpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemdqgraefgatpdagtcrw faeafslsandlsghpprvvstglpylllpvtaealgrarqvndlqealdklgaafvylldvdgregrt wdnlglvedvatgsaagpvaaylveyglaargepfvlhqgrflerpsrldvqvatdgsvrvgghvqlla raelltsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.18867
    Matthews' coefficent 2.10 Rfactor 0.16718
    Waters 913 Solvent Content 40.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u0k
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. PiQSi: protein quaternary structure investigation
    ED Levy - Structure, 2007 - Elsevier
     
    3. Protein design: From in silico to in vivo
    AB Chowdry - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch