.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u14

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom. To be Published
    Site MCSG
    PDB Id 1u14 Target Id APC24231
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5290,NP_463440, 99287 Molecular Weight 18517.87 Da.
    Residues 171 Isoelectric Point 5.34
    Sequence mhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrvdnarrlhpqa dfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgealgpvmsqytgideigrkeg aigvftagkltrssvyyqavilalspfhnavyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.68 Rfree 0.2135
    Matthews' coefficent 2.55 Rfactor 0.18219
    Waters 143 Solvent Content 51.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1u14
    1. House cleaning, a part of good housekeeping
    MY Galperin, OV Moroz, KS Wilson - Molecular , 2006 - Wiley Online Library
     
    2. Identification of an ITPase/XTPase in Escherichia coli by structural and biochemical analysis
    J Zheng, VK Singh, Z Jia - Structure, 2005 - Elsevier
     
    3. Crystal structure of VC0702 at 2.0 : conserved hypothetical protein from Vibrio cholerae
    S Ni, F Forouhar, DE Bussiere - Proteins: Structure, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch