.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of conserved hypothetical protein from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1u61 Target Id APC22682
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5228,AAP07193, 226900 Molecular Weight 15289.51 Da.
    Residues 135 Isoelectric Point 7.03
    Sequence midakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlletaflteee eavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivykaiavleeqeggtss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.2164
    Matthews' coefficent 6.50 Rfactor 0.20374
    Waters 77 Solvent Content 80.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u61
    1. Mini_III, an unusual member of the RNase III family of enzymes, catalyses 23S ribosomal RNA maturation in B. subtilis
    Y Redko, DH Bechhofer, C Condon - Molecular microbiology, 2008 - Wiley Online Library
     
    2. Ribosomal protein L3 bound to 23S precursor rRNA stimulates its maturation by Mini_III ribonuclease
    Y Redko, C Condon - Molecular microbiology, 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch