.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u7n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fatty acid/phospholipid synthesis protein PlsX from Enterococcus faecalis. J.STRUCT.FUNCT.GENOM. 10 157-163 2009
    Site MCSG
    PDB Id 1u7n Target Id APC28498
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5408,AAO82792, 226185 Molecular Weight 35833.35 Da.
    Residues 333 Isoelectric Point 5.44
    Sequence mkiavdamggdnapqaivegvmlakqdfpdiefqlygkeaeikkyitdeknitiihtdekiasddepvk airrkktasmvlaaqavkngeadaifsagntgallaaglfivgriknverpglmstlpvmgepdkgfdm ldlganadnkpehlvqyavlgsfyaekvrnvqnprvgllnngteetkgseltkkafellaadetinfvg nvearellngvadvvvtdgftgnavlksiegtamnmmsllktailsegvkgkmgalllknalhgmkdem dyskhggavlfglkapvikthgatgpdavrytirqihtmletqvvpqlveyyegkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.26 Rfree 0.26178
    Matthews' coefficent 2.56 Rfactor 0.20615
    Waters 307 Solvent Content 52.00

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;EOH (ETHANOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 1u7n
    1. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Predicting conserved essential genes in bacteria: in silico identification of putative drug targets
    M Duffield, I Cooper, E McAlister, M Bayliss, D Ford - Mol. BioSyst., 2010 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch