.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u83

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title PSL synthase from Bacillus subtilis. TO BE PUBLISHED
    Site MCSG
    PDB Id 1u83 Target Id APC1199
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4514,O06739, 1423 Molecular Weight 28355.34 Da.
    Residues 252 Isoelectric Point 4.57
    Sequence mndfslelpvrtnkpretgqsilidngyplqffkdaiagasdyidfvkfgwgtslltkdleekistlke hditfffggtlfekyvsqkkvnefhryctyfgceyieisngtlpmtnkekaayiadfsdeflvlsevgs kdaelasrqsseewleyivedmeagaekvitearesgtggicsssgdvrfqivddiissdidinrlife apnktlqqgfiqkigpnvnlanipfhdaialetlrlglrsdtffl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.219
    Matthews' coefficent 2.00 Rfactor 0.188
    Waters 176 Solvent Content 38.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 1u83
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    2. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch