.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u84

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of APC36109 from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1u84 Target Id APC36109
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5536,RBSTP1279, 1422 Molecular Weight 10077.92 Da.
    Residues 90 Isoelectric Point 4.64
    Sequence snamdgqqlnrlllewigawdpfglgkdaydveaasvlqavyetedartlaariqsiyefafdepipfp hclklarrllelkqaascplp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.25972
    Matthews' coefficent 2.10 Rfactor 0.2052
    Waters 128 Solvent Content 42.20

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1u84
    1. Computational design of proteins targeting the conserved stem region of influenza hemagglutinin
    SJ Fleishman, TA Whitehead, DC Ekiert, C Dreyfus - Science, 2011 - sciencemag.org
     
    2. Specific interactions for ab initio folding of protein terminal regions with secondary structures
    Y Yang, Y Zhou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Amino-acid-dependent main-chain torsion-energy terms for protein systems
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1206.3909, 2012 - arxiv.org
     
    4. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    5. Automatch: Target_binding protein design and enzyme design by automatic pinpointing potential active sites in available protein scaffolds
    C Zhang, L Lai - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch