.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u8x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel Catalytic Mechanism of Glycoside Hydrolysis Based on the Structure of an NAD(+)/Mn(2+)-Dependent Phospho-alpha-Glucosidase from Bacillus subtilis. STRUCTURE 12 1619-1629 2004
    Site MCSG
    PDB Id 1u8x Target Id APC1138
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4500,P54716, 1423 Molecular Weight 50510.90 Da.
    Residues 449 Isoelectric Point 4.93
    Sequence mkkksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfirekapdiefaa ttdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygmrsiggvleildymeky spdawmlnysnpaaivaeatrrlrpnskilnicdmpvgiedrmaqilglssrkemkvryyglnhfgwwt siqdqegndlmpklkehvsqygyipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmv kksnpnhtranevmegreafifsqcdmitreqssenseikiddhasyivdlaraiayntgermlliven ngaianfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalils ktvpnarvarliledlveankdfwpeldqsptris
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.221
    Matthews' coefficent 2.80 Rfactor 0.195
    Waters 162 Solvent Content 58.17

    Ligand Information
    Ligands G6P (ALPHA-D-GLUCOSE-6-PHOSPHATE) x 1;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals MN (MANGANESE) x 1

    Jmol

     
    Google Scholar output for 1u8x
    1. Toward the estimation of the absolute quality of individual protein structure models
    P Benkert, M Biasini, T Schwede - Bioinformatics, 2011 - Oxford Univ Press
     
    2. NAD+ and Metal-ion Dependent Hydrolysis by Family 4 Glycosidases: Structural Insight into Specificity for Phospho-_-d-glucosides
    A Varrot, VLY Yip, Y Li, SS Rajan, X Yang - Journal of molecular , 2005 - Elsevier
     
    3. Redox mechanism of glycosidic bond hydrolysis catalyzed by 6-phospho-_-glucosidase: a DFT study
    WJ Huang, J Llano, JW Gauld - The Journal of Physical Chemistry , 2010 - ACS Publications
     
    4. Applications of Potential Energy Surfaces in the Study of Enzymatic Reactions
    EAC Bushnell, WJ Huang, JW Gauld - Advances in Physical Chemistry, 2011 - hindawi.com
     
    5. Computational biology of Ras proteins
    AE Dellinger - 2006 - books.google.com
     
    6. INSILICO EXPRESSION AND IDENTIFICATION OF DRUG TARGET IN Aeromonas hydrophila
    A GANESH - 2008 - digitallibrary.srmuniv.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch