.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u9c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of DJI superfamily. To be Published
    Site MCSG
    PDB Id 1u9c Target Id APC35852
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5517,RBSTP0910, 1422 Molecular Weight 24405.11 Da.
    Residues 221 Isoelectric Point 5.11
    Sequence mskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldprsinekdpswaea eaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfaedgriiaavchgpsglvnatyk dgtpivkgktvtsftdeeerevgldvhmpfllestlrlrganfvrggkwtdfsvrdgnlitgqnpqssr staekvvaaleere
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.19729
    Matthews' coefficent 2.40 Rfactor 0.17215
    Waters 187 Solvent Content 48.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u9c
    1. Identification of functional subclasses in the DJ-1 superfamily proteins
    Y Wei, D Ringe, MA Wilson - PLoS computational , 2007 - dx.plos.org
     
    2. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch