.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u9d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Protein from Vibrio cholerae O1 biovar eltor str. N16961. TO BE PUBLISHED
    Site MCSG
    PDB Id 1u9d Target Id APC26373
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5353,AAF93879, 243277 Molecular Weight 12234.35 Da.
    Residues 107 Isoelectric Point 5.14
    Sequence mphlrfraveahiveslvptllnelssllstarnaftfelintqyfaeggvypmvevlwfgreqqtqdq iaqvitdqirqllgadshlavvfiplqrtayyldgqhf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.23702
    Matthews' coefficent 2.27 Rfactor 0.18903
    Waters 153 Solvent Content 45.73

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1u9d
    1. Predicting protein function and binding profile via matching of local evolutionary and geometric surface patterns
    YY Tseng, J Dundas, J Liang - Journal of molecular biology, 2009 - Elsevier
     
    2. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    3. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch