.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vpd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of GarR-tartronate semialdehyde reductase from Salmonella typhimurium. J Struct Funct Genomics 10 249-253 2009
    Site MCSG
    PDB Id 1vpd Target Id APC25435
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5332,NP_462161, 99287 Molecular Weight 30726.90 Da.
    Residues 296 Isoelectric Point 5.54
    Sequence mtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdviitmlpns phvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapvsggepkaidgtlsvmv ggdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivalniaamsealtlatkagvnpdlvyqai rgglagstvldakapmvmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgn ddhsalacyyeklakvevtr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.144
    Matthews' coefficent 3.60 Rfactor 0.12
    Waters 497 Solvent Content 66.00

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1vpd
    1. Proteins: coexistence of stability and flexibility
    S Reuveni, R Granek, J Klafter - of the 3rd International Conference on , 2008 - dl.acm.org
     
    2. Structural and Kinetic Properties of a _-Hydroxyacid Dehydrogenase Involved in Nicotinate Fermentation
    S Reitz, A Alhapel, LO Essen, AJ Pierik - Journal of molecular biology, 2008 - Elsevier
     
    3. X-Ray crystal structure of GarRtartronate semialdehyde reductase from Salmonella typhimurium
    J Osipiuk, M Zhou, S Moy, F Collart - Journal of structural and , 2009 - Springer
     
    4. A novel predicting algorithm of thermostable proteins based on choquet integral with respect to L-measure and hurst exponent
    JI Shieh, YL Liu, KJ Lee, PC Chang - Machine Learning and , 2009 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1tea.png
    No description
    25.17 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch