.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wpb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Escherichia coli yfbU gene product. To be Published
    Site MCSG
    PDB Id 1wpb Target Id APC042
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4421,AAC75354, 562 Molecular Weight 19535.28 Da.
    Residues 164 Isoelectric Point 6.07
    Sequence memtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelkeetcrtiidimemy halhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegrythfdagthgfnaqtpmwekyq rmlnvwhacprqyhlsaneinqiina
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 16
    Resolution (Å) 2.00 Rfree 0.22652
    Matthews' coefficent 2.80 Rfactor 0.18951
    Waters 1618 Solvent Content 55.30

    Ligand Information
    Ligands GOL (GLYCEROL) x 44
    Metals CL (CHLORIDE) x 36

    Jmol

     
    Google Scholar output for 1wpb
    1. A genomic and expression compendium of the expanded PEBP gene family from maize
    ON Danilevskaya, X Meng, Z Hou, EV Ananiev - Plant , 2008 - Am Soc Plant Biol
     
    2. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch