.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x7f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized B. cereus protein. To be Published
    Site MCSG
    PDB Id 1x7f Target Id APC22732
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5231,AAP07802, 226900 Molecular Weight 41163.71 Da.
    Residues 361 Isoelectric Point 5.35
    Sequence merklgislypehstkekdmayisaaarhgfsriftcllsvnrpkeeivaefkeiinhakdnnmevild vapavfdqlgisysdlsffaelgadgirldvgfdglteakmtnnpyglkielnvsndiaylenilshqa nksaligchnfypqkftglpydyfircserfkkhgirsaafitshvanigpwdindglctleehrnlpi evqakhlwatgliddviignayaseeeleklgnlnrymlqlkvhfvdeatevekratlqelhvrrgdit eymvrstevrkkykdydfpvresvlqergqvvignnsfgkykgelqiilkempiderknivgtiaeeel flldyvgawtqftcve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.23175
    Matthews' coefficent 2.80 Rfactor 0.17115
    Waters 376 Solvent Content 55.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x7f
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Crystal structure of TM1367 from Thermotoga maritima at 1.90 resolution reveals an atypical member of the cyclophilin (peptidylprolyl isomerase) fold
    KK Jin, S Krishna, R Schwarzenbacher - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    4. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch