.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x87

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.4A X-ray structure of Urocanase protein complexed with NAD. To be Published
    Site MCSG
    PDB Id 1x87 Target Id APC36227
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5544,RBSTP1523, 1422 Molecular Weight 60107.51 Da.
    Residues 551 Isoelectric Point 5.96
    Sequence maekrtvrpfagterrakgwiqeaalrmlnnnlhpdvaerpdelivyggigkaarnwecyeaivdtllr lendetlliqsgkpvavfrthpdaprvliansnlvpawatwdhfheldkkglimygqmtagswiyigsq givqgtyetfaevarqhfggtlagtitltaglggmggaqplavtmnggvclaievdpariqrridtnyl dtmtdsldaalemakqakeekkalsiglvgnaaevlprlvetgfvpdvltdqtsahdplngyipagltl deaaelrardpkqyiarakqsiaahvramlamqkqgavtfdygnnirqvakdegvddafsfpgfvpayi rplfcegkgpfrwvalsgdpediyktdevilrefsdnerlchwirmaqkrikfqglparicwlgygera kfgkiindmvakgelkapivigrdhldsgsvaspnretegmkdgsdaiadwpilnallnavggaswvsv hhgggvgmgysihagmvivadgtkeaekrlervlttdpglgvirhadagyelairtakekgidmpmlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.23241
    Matthews' coefficent 2.37 Rfactor 0.18651
    Waters 218 Solvent Content 48.17

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1x87
    1. Similarity search for local protein structures at atomic resolution by exploiting a database management system
    AR Kinjo, H Nakamura - Biophysics, 2007 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch