.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xa0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MCSG Target APC35536 from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1xa0 Target Id APC35536
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5493,RBSTP2758, 1422 Molecular Weight 35336.77 Da.
    Residues 328 Isoelectric Point 6.73
    Sequence msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktypfvpgidla gvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgltlkeamaigtagftaalsi hrleehgltpergpvlvtgatggvgslavsmlakrgytveastgkaaehdylrvlgakevlaredvmae rirpldkqrwaaavdpvggrtlatvlsrmryggavavsgltggaevpttvhpfilrgvsllgidsvycp mdlrlriwerlagdlkpdleriaqeislaelpqalkrilrgelrgrtvvrla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.26931
    Matthews' coefficent 2.90 Rfactor 0.21235
    Waters 48 Solvent Content 57.20

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1xa0
    1. The crystal structure of galactitol-1-phosphate 5-dehydrogenase from Escherichia coli K12 provides insights into its anomalous behavior on IMAC processes
    M Esteban-Torres, Y lvarez, I Acebrn, B de las Rivas - FEBS Letters, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch