.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xaf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein YfiH from Shigella flexneri at 2 A resolution. Proteins 63 1097-1101 2006
    Site MCSG
    PDB Id 1xaf Target Id APC27896
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5394,AAP17973, 198215 Molecular Weight 26378.65 Da.
    Residues 243 Isoelectric Point 6.52
    Sequence msklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlpskpvwleq vhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtevaavhagwrglcagvleet vscfadkpenilawlgpaigprafevgaevreafmavdakasaafiqhgdkyladiyqlarqrlanvgv eqifggdrctytenetffsyrrdkttgrmasfiwli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.25159
    Matthews' coefficent 2.20 Rfactor 0.1786
    Waters 420 Solvent Content 46.00

    Ligand Information
    Ligands ACT (ACETATE) x 5;GOL (GLYCEROL) x 2
    Metals ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 1xaf
    1. A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation
    X Chao, TJ Muff, SY Park, S Zhang, AM Pollard - Cell, 2006 - Elsevier
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins
    BA Wilson, M Ho - Future microbiology, 2010 - Future Medicine
     
    4. Crystal structure of hypothetical protein YfiH from Shigella flexneri at 2 resolution
    Y Kim, N Maltseva, I Dementieva - Proteins: Structure, , 2006 - Wiley Online Library
     
    5. Structure-based de novo prediction of zinc-binding sites in proteins of unknown function
    W Zhao, M Xu, Z Liang, B Ding, L Niu, H Liu - , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch