.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xak

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein. Structure 13 75-85 2005
    Site MCSG
    PDB Id 1xak Target Id APC35380
    Molecular Characteristics
    Source Sars coronavirus urbani
    Alias Ids TPS5491,AAP13449, 228330 Molecular Weight 13940.56 Da.
    Residues 122 Isoelectric Point 8.24
    Sequence mkiilfltlivftscelyhyqecvrgttvllkepcpsgtyegnspfhpladnkfaltctsthfafacad gtrhtyqlrarsvspklfirqeevqqelysplflivaalvflilcftikrkte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.275
    Matthews' coefficent 2.34 Rfactor 0.223
    Waters 142 Solvent Content 47.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xak
    1. Structural insights into SARS coronavirus proteins
    M Bartlam, H Yang, Z Rao - Current opinion in structural biology, 2005 - Elsevier
     
    2. A Combined QM/MM Poisson_ Boltzmann Approach
    SA Hayik, N Liao, KM Merz Jr - Journal of Chemical Theory and , 2008 - ACS Publications
     
    3. Solution structure of the X4 protein coded by the SARS related coronavirus reveals an immunoglobulin like fold and suggests a binding activity to integrin I domains
    K Hnel, T Stangler, M Stoldt, D Willbold - Journal of biomedical science, 2006 - Springer
     
    4. PURY: a database of geometric restraints of hetero compounds for refinement in complexes with macromolecular structures
    M Andrejasic, J Praznikar, D Turk - Acta Crystallographica Section D: , 2008 - scripts.iucr.org
     
    5. Development of a Parametrized Force Field To Reproduce Semiempirical Geometries
    AM Wollacott, KM Merz Jr - Journal of Chemical Theory and , 2006 - ACS Publications
     
    6. A novel force field parameter optimization method based on LSSVR for ECEPP
    Y Liu, L Tao, J Lu, S Xu, Q Ma - FEBS letters, 2011 - Elsevier
     
    7. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    8. Amino-acid-dependent main-chain torsion-energy terms for protein systems
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1206.3909, 2012 - arxiv.org
     
    9. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch