.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xau

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator. J.Immunol. 180 940-947 2008
    Site MCSG
    PDB Id 1xau Target Id APC35310
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS5490,AAP44002.1, 10090 Molecular Weight 34528.47 Da.
    Residues 306 Isoelectric Point 6.82
    Sequence mktvpamlgtprlfreffilhlglwsilcekatkrndeecevqlnikrnskhsawtgelfkiecpvkyc vhrpnvtwckhngtiwvplevgpqlytsweenrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsv tihvrertqnssehplitvsdipdatnasgpstmeerpgrtwllytllplgalllllacvcllcflkri qgkekkpsdlagrdtnlvdipassrtnhqalpsgtgiydndpwssmqdeseltislqsernnqgivyas lnhcvigrnprqennmqeapteyasicvrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.269
    Matthews' coefficent 2.20 Rfactor 0.206
    Waters 225 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals CD (CADMIUM) x 2

    Jmol

     
    Google Scholar output for 1xau
    1. Attenuating Lymphocyte Activity
    DM Compaan, LC Gonzalez, I Tom, KM Loyet - Journal of Biological , 2005 - ASBMB
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator
    CA Nelson, MD Fremont, JR Sedy - The Journal of , 2008 - Am Assoc Immnol
     
    4. A C-Terminal Lobe of the _ Subunit of Na, K-ATPase and H, K-ATPase Resembles Cell Adhesion Molecules
    E Bab-Dinitz, S Albeck, Y Peleg, V Brumfeld - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch