.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xbw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Staphylococcus aureus IsdG and IsdI, heme-degrading enzymes with structural similarity to monooxygenases. J.Biol.Chem. 280 2840-2846 2005
    Site MCSG
    PDB Id 1xbw Target Id APC007
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4409,NP_645835, 1280 Molecular Weight 12545.68 Da.
    Residues 107 Isoelectric Point 6.29
    Sequence mkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwkskqaftdwlk sdvfkaahkhvrsknedesspiinnkvitydigysymk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.285
    Matthews' coefficent 2.29 Rfactor 0.23
    Waters 197 Solvent Content 44.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xbw
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus
    WC Lee, ML Reniere, EP Skaar, MEP Murphy - Journal of Biological , 2008 - ASBMB
     
    3. A novel chimera: The truncated hemoglobin-antibiotic monooxygenase from Streptomyces avermitilis
    A Bonamore, A Attili, F Arenghi, B Catacchio - Gene, 2007 - Elsevier
     
    4. Chlorite dismutases, DyPs, and EfeB: 3 microbial heme enzyme families comprise the CDE structural superfamily
    B Goblirsch, RC Kurker, BR Streit, CM Wilmot - Journal of molecular , 2011 - Elsevier
     
    5. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    6. TA Binkowski, A Joachimiak - BMC structural biology, 2008 - BioMed Central Ltd
    30
     
    7. Bacillus subtilis HmoB is a heme oxygenase with a novel structure
    S Park, J Choe - Biochemistry and Molecurar Biology Reports, 2012 - papersearch.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch