.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xc2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Pyrroline-5-Carboxylate Reductase from Neisseria meningitides MC58. To be Published
    Site MCSG
    PDB Id 1xc2 Target Id APC28591
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5414,AAF40524, 122586, Molecular Weight 28339.83 Da.
    Residues 263 Isoelectric Point 6.92
    Sequence mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddvlilavkpqdm eaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglgvsgmyaeaevsetdrriad rimksvgltvwlddeekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalae qtgedfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24084
    Matthews' coefficent 2.60 Rfactor 0.19515
    Waters 248 Solvent Content 51.90

    Ligand Information
    Ligands PRO x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
    1yqg.png
    No description
    20.64 kB22:12, 30 Jun 2008dweekesActions
    2ag8.png
    No description
    20.78 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch