.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xeb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1xeb Target Id APC22065
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5209,AAG03505, 208964 Molecular Weight 17083.71 Da.
    Residues 150 Isoelectric Point 5.86
    Sequence msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqllaylrlldp vrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlqayygrygfvavtevyl eddiphigmrra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.35 Rfree 0.282
    Matthews' coefficent 2.76 Rfactor 0.232
    Waters 222 Solvent Content 54.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch