.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xfk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8A crystal structure of formiminoglutamas from Vibrio cholerae O1 biovar eltor str. N16961. To be Published
    Site MCSG
    PDB Id 1xfk Target Id APC26492
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5358,AAF94363, 243277 Molecular Weight 37327.07 Da.
    Residues 336 Isoelectric Point 5.76
    Sequence mnpnfttehtwqgrhdpedgqagrrvhhiacpiqvgelanqepgvaligfecdagvernkgrtgakhap slikqalanlawhhpipiydlgnircegdeleqaqqecaqviqqalpharaivlgggheiawatfqgla qhflatgvkqprigiinfdahfdlrtfeselapvrpssgtpfnqihhfcqqqgwdfhyaclgvsrasnt palferadklgvwyvedkafsplslkdhltqlqhfiddcdylyltidldvfpaasapgvsapaargvsl ealapyfdrilhyknklmiadiaeynpsfdidqhtarlaarlcwdianamaeqvqsirhp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.229
    Matthews' coefficent 2.99 Rfactor 0.202
    Waters 204 Solvent Content 57.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xfk
    1. A Common Catalytic Mechanism for Proteins of the HutI Family
    R Tyagi, S Eswaramoorthy, SK Burley, FM Raushel - Biochemistry, 2008 - ACS Publications
     
    2. Fast algorithms for computing the constrained LCS of run-length encoded strings
    HY Ann, CB Yang, CT Tseng, CY Hor - Theoretical Computer Science, 2012 - Elsevier
     
    3. Protein preparation, crystallization and preliminary X-ray analysis of imidazolonepropionase from Bacillus subtilis
    Y Yu, L Li, X Zheng, YH Liang, XD Su - et Biophysica Acta (BBA)-Proteins & , 2006 - Elsevier
     
    4. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    5. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    6. Regulation of the Histidine Utilization (Hut) System in Bacteria
    RA Bender - Microbiology and Molecular Biology Reviews, 2012 - Am Soc Microbiol
     
    7. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    8. Soft energy function and generic evolutionary method for discriminating native from nonnative protein conformations
    Y Chiu, J Hwang, J Yang - Journal of computational chemistry, 2008 - Wiley Online Library
     
    9. Protein loop prediction by fragment assembly
    Z Liu - Masters Abstracts International, 2007 - el.trc.gov.om
     
    10. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     
    11. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    12. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch