.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xg8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.1A crystal structure of hypothetical protein SA0798 from Staphylococcus aureus. To be Published
    Site MCSG
    PDB Id 1xg8 Target Id APC23712
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5278,NP_374059, 158879 Molecular Weight 12050.03 Da.
    Residues 102 Isoelectric Point 4.51
    Sequence mvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdndnltdhdlqfierieqdel fyplitmndeyvadgyiqtkqitrfidqklvne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.283
    Matthews' coefficent 2.35 Rfactor 0.229
    Waters 41 Solvent Content 45.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xg8
    1. Can molecular dynamics simulations provide high_resolution refinement of protein structure?
    J Chen, CL Brooks III - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. Role of topology, nonadditivity, and water-mediated interactions in predicting the structures of _/_ proteins
    C Zong, GA Papoian, J Ulander - Journal of the American , 2006 - ACS Publications
     
    4. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    5. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    8. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    9. Protein loop prediction by fragment assembly
    Z Liu - Masters Abstracts International, 2007 - el.trc.gov.om
     
    10. Protein Structure Prediction Using a Profile-Profile Comparison Method: FORTE
    _____ - ____, 2006 - J-STAGE
     
    11. Theoretical studies of biomolecular self-assembly near equilibrium and far from equilibrium
    C Zong - 2007 - escholarship.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch