.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xhd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative acetyltransferase, product of BC4754 gene from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1xhd Target Id APC26171
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5344,AAP11659, 226900 Molecular Weight 18839.62 Da.
    Residues 170 Isoelectric Point 6.42
    Sequence miypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnvqdqctlhqspqy plileddvtvghqvilhschikkdaligmgsiildgaeigegafigagslvsqgkkippntlafgrpak vireltaedrkdmerirtqyvekgqyykslqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.1632
    Matthews' coefficent 6.30 Rfactor 0.15243
    Waters 130 Solvent Content 80.20

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xhd
    1. Post to
    A Paiardini, R Sali, F Bossa - BMC structural , 2008 - biomedcentral.com
     
    2. The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism
    L Schuldt, S Weyand, G Kefala, MS Weiss - Journal of molecular biology, 2009 - Elsevier
     
    3. Conformation and sequence evidence for two-fold symmetry in left-handed beta-helix fold
    X Shen - Journal of Theoretical Biology, 2011 - Elsevier
     
    4. Structures of the-class carbonic anhydrase homologue YrdA suggest a possible allosteric switch
    HM Park, JH Park, JW Choi, J Lee, BY Kim - Section D: Biological , 2012 - scripts.iucr.org
     
    5. The Physics of Amyloid Matter: New Algorithm for Left Handed Beta Helical Structure Prediction and A Model For Extra-Cellular and PrPc Assisted Abeta Aggregation
    Y Dar - 2012 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch