.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xjc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus. To be Published
    Site MCSG
    PDB Id 1xjc Target Id APC35871
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5521,RBSTP0958, 1422 Molecular Weight 18782.55 Da.
    Residues 166 Isoelectric Point 6.30
    Sequence mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhghggeparpegvdsvrheragavatavegdg llqlhlrrplwrlddvlalyaplrldlvlvegykqerhpkvvlvrseedwaslqhlaniraviaweple gplahpvfsladddeyipwlmnevrtrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2249
    Matthews' coefficent 2.70 Rfactor 0.1955
    Waters 81 Solvent Content 54.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xjc
    1. Crystal structure of human antibody 2909 reveals conserved features of quaternary structure-specific antibodies that potently neutralize HIV-1
    A Changela, X Wu, Y Yang, B Zhang, J Zhu - Journal of , 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch