.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xm7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the hypothetical protein aq_1665 from Aquifex aeolicus. To be Published
    Site MCSG
    PDB Id 1xm7 Target Id APC22223
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS5214,NP_214148, 224324 Molecular Weight 23460.75 Da.
    Residues 193 Isoelectric Point 6.37
    Sequence mmyfisdthfyheniinlnpevrfkgfeiviltnllkvlkpedtlyhlgdftwhfndkneylriwkalp grkilvmgnhdkdkeslkeyfdeiydfykiiehkgkrillshypakdpiterypdrqemvreiyfkenc dllihghvhwnregikcackdyriecinanvewndykpisereidklisyekakn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.267
    Matthews' coefficent 3.05 Rfactor 0.209
    Waters 70 Solvent Content 58.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xm7
    1. Evaluation of features for catalytic residue prediction in novel folds
    E Youn, B Peters, P Radivojac, SD Mooney - Protein science, 2007 - Wiley Online Library
     
    2. Structure_based function inference using protein family_specific fingerprints
    D Bandyopadhyay, J Huan, J Liu, J Prins - Protein , 2006 - Wiley Online Library
     
    3. Structural Basis of the Initial Binding of tRNAIle Lysidine Synthetase TilS with ATP and L-Lysine
    M Kuratani, Y Yoshikawa, Y Bessho, K Higashijima - Structure, 2007 - Elsevier
     
    4. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch