.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xmx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein VC1899 from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 1xmx Target Id APC26666
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5363,AAF95047, 243277 Molecular Weight 43584.05 Da.
    Residues 383 Isoelectric Point 5.45
    Sequence maihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdffeipagsntsai ksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvepnsdclcwlypegnndtqvqd ritiadyltifgargefnehqlspqldqqlyqlgerwasnalelgpglatlnylattcrkeqkldvels dkqqgyrelnlllsdlveakiasyengiltfineearrfangewletlvhstvkqiqddmptiqdrsln vqvyrqlgerevrneldvatvvnnklhiiecktkgmrddgddtlykleslrdllgglqaramlvsfrpl rhnditraedlglaligpdelkdlkthltqwfkaaggn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.25371
    Matthews' coefficent 2.50 Rfactor 0.16836
    Waters 396 Solvent Content 49.65

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;FMT (FORMIC) x 6
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1xmx
    1. A putative RNA-interference-based immune system in prokaryotes: computational analysis of the predicted enzymatic machinery, functional analogies with
    KS Makarova, NV Grishin, SA Shabalina, YI Wolf - Biology , 2006 - biomedcentral.com
     
    2. Topology of Type II REases revisited; structural classes and the common conserved core
    MY Niv, DR Ripoll, JA Vila, A Liwo - Nucleic acids , 2007 - Oxford Univ Press
     
    3. The structure of the CRISPR-associated protein Csa3 provides insight into the regulation of the CRISPR/Cas system
    NG Lintner, KA Frankel, SE Tsutakawa - Journal of Molecular , 2011 - Elsevier
     
    4. Concurrent proinflammatory and apoptotic activity of a Helicobacter pylori protein (HP986) points to its role in chronic persistence
    A Alvi, SA Ansari, NZ Ehtesham, M Rizwan, S Devi - PloS one, 2011 - dx.plos.org
     
    5. A putative RNA-interference-based immune system in prokaryotes: the epitome of prokaryotic genomic diversity
    EV Koonin, KS Makarova, NV Grishin - SYMPOSIA-SOCIETY , 2006 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch