.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative citrate lyase alpha chain/citrate-ACP transferase from Salmonella typhimurium. To be Published
    Site MCSG
    PDB Id 1xr4 Target Id APC22880
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5244,NP_459066, 99287 Molecular Weight 54547.22 Da.
    Residues 506 Isoelectric Point 5.94
    Sequence mketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkngmtisfhhafrg gdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiytsglrgklgeeisaglmenpvq ihshggrvkliqsgelnidvaflgvpccdefgnangfsgksrcgslgyaqvdaqyakcvvllteewvef pnypasiaqdqvdlivqvdevgdpekitagairlssnprelliarqaanviehsgyfcdgfslqtgtgg aslavtrfledkmrrhnitasfglggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistn qyanpaskgaacerlnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgri pcvvekvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgkpqpieft drvvavvryrdgsvidvirqvkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.37 Rfree 0.2348
    Matthews' coefficent 2.90 Rfactor 0.193
    Waters 287 Solvent Content 57.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xr4
    1. Crystal contacts as nature's docking solutions
    E Krissinel - Journal of computational chemistry, 2010 - Wiley Online Library
     
    2. Diversification of catalytic activities and ligand interactions in the protein fold shared by the sugar isomerases, eIF2B, DeoR transcription factors, acyl-CoA transferases
    V Anantharaman, L Aravind - Journal of molecular biology, 2006 - Elsevier
     
    3. New benchmark metrics for protein_protein docking methods
    M Gao, J Skolnick - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch