.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein similar to alpha-acetolactate. To be Published
    Site MCSG
    PDB Id 1xv2 Target Id APC23686
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus n315
    Alias Ids TPS5276,NP_375720, 158879 Molecular Weight 26405.41 Da.
    Residues 234 Isoelectric Point 5.11
    Sequence mtnvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehkefielkgde kvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhmhvrmmpaqqppytrlid sarrqpeekrqdirgaivgfftpelfhgvgsagfhihfadderaygghvldfevddvvveiqnfetfqq hfpvnnetfvkakidykdvaeeireae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.236
    Matthews' coefficent 2.38 Rfactor 0.191
    Waters 657 Solvent Content 51.22

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 1xv2
    1. Zinc through the three domains of life
    C Andreini, L Banci, I Bertini - Journal of proteome , 2006 - ACS Publications
     
    2. firestarprediction of functionally important residues using structural templates and alignment reliability
    G Lpez, A Valencia, ML Tress - Nucleic acids research, 2007 - Oxford Univ Press
     
    3. Assessment of CASP6 predictions for new and nearly new fold targets
    JJ Vincent, CH Tai - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Gene identification and structural characterization of the pyridoxal 5'-phosphate degradative protein 3-hydroxy-2-methylpyridine-4, 5-dicarboxylate decarboxylase
    T Mukherjee, KM McCulloch, SE Ealick, TP Begley - Biochemistry, 2007 - ACS Publications
     
    6. Crystal structure of Homo sapiens PTD012 reveals a zinc_containing hydrolase fold
    BA Manjasetty, K Bssow, M Fieber_Erdmann - Protein , 2006 - Wiley Online Library
     
    7. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    8. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch