.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12. To be Published
    Site MCSG
    PDB Id 1xvi Target Id APC5010
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4636,AAC75021, 83333 Molecular Weight 30437.71 Da.
    Residues 271 Isoelectric Point 4.93
    Sequence mfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqktlglqglpli aengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfddvddatiaewtglsrsqaa ltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwhvldasagkdqaanwiiatyqqlsgkrp ttlglgdgpndapllevmdyavivkglnregvhlhdedparvwrtqregpegwregldhffsar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.26 Rfree 0.24334
    Matthews' coefficent 2.70 Rfactor 0.18388
    Waters 388 Solvent Content 54.80

    Ligand Information
    Ligands SO4 (SULFATE) x 3;1PE (PENTAETHYLENE) x 1;PG4 (TETRAETHYLENE) x 1;PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xvi
    1. HKL-3000: the integration of data reduction and structure solution-from diffraction images to an initial model in minutes
    W Minor, M Cymborowski, Z Otwinowski - Section D: Biological , 2006 - scripts.iucr.org
     
    2. Evolutionary genomics of the HAD superfamily: understanding the structural adaptations and catalytic diversity in a superfamily of phosphoesterases and allied
    AM Burroughs, KN Allen, D Dunaway-Mariano - Journal of molecular , 2006 - Elsevier
     
    3. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    4. Crystallization and preliminary X-ray analysis of mannosyl-3-phosphoglycerate phosphatase from Thermus thermophilus HB27
    S Goncalves, AM Esteves, N Borges - Section F: Structural , 2011 - scripts.iucr.org
     
    5. Three-Dimensional Structure of Mannosyl-3-phosphoglycerate Phosphatase from Thermus thermophilus HB27: A New Member of the Haloalcanoic Acid
    S Gonc_alves, AM Esteves, H Santos, N Borges - Biochemistry, 2011 - ACS Publications
     
    6. Structural Studies of Human 5'-Nucleotidases
    K Walldn - 2008 - su.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch