.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xvs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of apaG from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 1xvs Target Id APC26324
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor
    Alias Ids TPS5349,AAF93615, 686 Molecular Weight 14275.47 Da.
    Residues 126 Isoelectric Point 4.57
    Sequence mdvslpcikiqvqtryieeqsnpeyqrfvfaylitiknlssqtvqlmsrrwlitdadgkqtvvegdgvv geqprikandeytyssgtaldtpvgvmqgqylmideqgesftveiepfrlavphvln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.26585
    Matthews' coefficent 2.54 Rfactor 0.17997
    Waters 248 Solvent Content 52.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xvs
    1. Protein docking using surface matching and supervised machine learning
    AJ Bordner, AA Gorin - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    2. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    3. Preparation, crystallization and preliminary X-ray analysis of XC2382, an ApaG protein of unknown structure from Xanthomonas campestris
    KH Chin, CC Chou, CC Lee, HL Shr, PC Lyu - Section F: Structural , 2005 - scripts.iucr.org
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch