.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xwm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of PhoU (phosphate uptake regulator). To be Published
    Site MCSG
    PDB Id 1xwm Target Id APC36012
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS5531,RBSTP1653, 1422 Molecular Weight 24325.54 Da.
    Residues 217 Isoelectric Point 4.80
    Sequence mretfaddlrslhnkliemgrltevalqqaieafqtqnknlamavidgdgsidkleeevndfalwliak qqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmyrlatdmvstaiaayd redaslaaqiadmdhrvdeqygemmksllevektdketlaqmnvlalvaryiertadhatniaehlvyl vkgkhydfnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.334
    Matthews' coefficent 2.29 Rfactor 0.243
    Waters 5 Solvent Content 44.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xwm
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. Defining the Functional Domain of Programmed Cell Death 10 through Its Interactions with Phosphatidylinositol-3, 4, 5-Trisphosphate
    CF Dibble, JA Horst, MH Malone, K Park, B Temple - PLoS One, 2010 - dx.plos.org
     
    3. A novel feature with dynamic time warping and least squares adjustment for protein structure alignment
    H HSIAO, WH Hsiao, CK Hsu, JJP Tsai - 2006 - asiair.asia.edu.tw
     
    4. Analogy-based protein structure prediction: I. A new database of spatially similar and dissimilar structures of protein domains for testing and optimizing prediction
    MY Lobanov, NS Bogatyreva, DN Ivankov - Molecular Biology, 2009 - Springer
     
    5. Helical packing regulates structural transitions in BAX.
    N Tschammer - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch