.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A virulence locus of Pseudomonas aeruginosa encodes a protein secretion apparatus. Science 312 1526-1530 2006
    Site MCSG
    PDB Id 1y12 Target Id APC22049
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5207,AAG03475, 208964 Molecular Weight 17413.83 Da.
    Residues 162 Isoelectric Point 6.29
    Sequence mavdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftkyidkstpnl mmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrltenvtlnfaqvqvdyqp qkadgakdggpvkygwnirqnvqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.95 Rfree 0.22665
    Matthews' coefficent 2.50 Rfactor 0.1794
    Waters 537 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y12
    1. In vitro self-assembly of tailorable nanotubes from a simple protein building block
    ER Ballister, AH Lai, RN Zuckermann - Proceedings of the , 2008 - National Acad Sciences
     
    2. The phage _ major tail protein structure reveals a common evolution for long-tailed phages and the type VI bacterial secretion system
    LG Pell, V Kanelis, LW Donaldson - Proceedings of the , 2009 - National Acad Sciences
     
    3. Crystal Structure of Bacteriophage SPP1 Distal Tail Protein (gp19. 1)
    D Veesler, G Robin, J Lichire, I Auzat - Journal of Biological , 2010 - ASBMB
     
    4. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    5. Phages have adapted the same protein fold to fulfill multiple functions in virion assembly
    L Cardarelli, LG Pell, P Neudecker - Proceedings of the , 2010 - National Acad Sciences
     
    6. Structure and molecular assignment of lactococcal phage TP901-1 baseplate
    C Bebeacua, P Bron, L Lai, CS Vegge - Journal of Biological , 2010 - ASBMB
     
    7. Structural basis for the secretion of EvpC: a key type VI secretion system protein from Edwardsiella tarda
    C Jobichen, S Chakraborty, M Li, J Zheng, L Joseph - PloS one, 2010 - dx.plos.org
     
    8. Activation of ubiquitin and ubiquitin-like proteins
    FC Streich, AL Haas - Conjugation and Deconjugation of Ubiquitin Family , 2010 - Springer
     
    9. Structural biology of type VI secretion systems
    E Cascales, C Cambillau - of the Royal , 2012 - rstb.royalsocietypublishing.org
     
    10. Protein cages, rings and tubes: useful components of future nanodevices?
    JG Heddle - Nanotechnology, Science and Applications, 2008 - dovepress.com
     
    11. The biochemical properties of the Francisella pathogenicity island (FPI)-encoded proteins IglA, IglB, IglC, PdpB and DotU suggest roles in type VI secretion
    OM de Bruin, BN Duplantis, JS Ludu, RF Hare - , 2011 - Soc General Microbiol
     
    12. Sumoylation as a signal for polyubiquitylation and proteasomal degradation
    M Miteva, K Keusekotten, K Hofmann - and Deconjugation of , 2010 - Springer
     
    13. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    14. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    15. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    16. Protein yoctowell nanoarchitectures: assembly of donut shaped protein containers and nanofibres
    A Schreiber, E Zaitseva, Y Thomann, R Thomann - Soft Matter, 2011 - pubs.rsc.org
     
    17. Structural insights into the effectorimmunity system Tse1/Tsi1 from Pseudomonas aeruginosa
    J Benz, C Sendlmeier, TRM Barends, A Meinhart - PloS one, 2012 - dx.plos.org
     
    18. Phytobacterial Type VI secretion system-gene distribution, phylogeny, structure and biological functions
    PF Sarris, EA Trantas, N Skandalis - , Cumagun, CJ (Ed.), , 2012 - cdn.intechopen.com
     
    19. Gene Ontology term prediction based upon amino acid occurrence
    Y Taguchi, MM Gromiha - Neural Networks, 2008. IJCNN 2008.( , 2008 - ieeexplore.ieee.org
     
    20. The Pathogenic Potential of Helicobacter pullorum: Possible Role for the Type VI Secretion System
    A Sirianni, NO Kaakoush, MJ Raftery - Helicobacter, 2012 - Wiley Online Library
     
    21. Long Noncontractile Tail Machines of Bacteriophages
    AR Davidson, L Cardarelli, LG Pell, DR Radford - Viral Molecular , 2012 - Springer
     
    22. Detection of Spatial Correlations in Protein Structures and Molecular Complexes
    MJ Sippl, M Wiederstein - Structure, 2012 - Elsevier
     
    23. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    24. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch