.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y5e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Molybdenum cofactor biosynthesis protein B. TO BE PUBLISHED
    Site MCSG
    PDB Id 1y5e Target Id APC25161
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5324,AAP11663, 226900 Molecular Weight 18534.36 Da.
    Residues 169 Isoelectric Point 6.31
    Sequence msvtehkkqapkevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyh kedvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggtigrkvvf smpgssgavrlamnklilpelghitfelhrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.215
    Matthews' coefficent 2.90 Rfactor 0.188
    Waters 437 Solvent Content 57.60

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1;IMD (IMIDAZOLE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1y5e
    1. Structure of hypothetical Mo-cofactor biosynthesis protein B (ST2315) from Sulfolobus tokodaii
    SV Antonyuk, RW Strange, MJ Ellis - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch