.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y71

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of kinase-associated protein B from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 1y71 Target Id APC25178
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5325,AAP11783, 226900 Molecular Weight 14623.92 Da.
    Residues 127 Isoelectric Point 5.94
    Sequence mretfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvpffherralafre qtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.265
    Matthews' coefficent 2.30 Rfactor 0.214
    Waters 108 Solvent Content 46.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y71
    1. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Methyl esterase 1 (StMES1) is required for systemic acquired resistance in potato
    PM Manosalva, SW Park, F Forouhar - Molecular Plant- , 2010 - Am Phytopath Society
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch